PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04844.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 376aa    MW: 39895.5 Da    PI: 6.5919
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04844.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-164895148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  rg W++eEd++l + ++++G g+W+++++  g+ R++k+c++rw +yl
  Zmw_sc04844.1.g00010.1.am.mk 48 RGLWSPEEDDKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 95
                                  788*******************************************97 PP

2Myb_DNA-binding51.81.9e-16101145147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg++++eE++l+++++  lG++ W+ Ia+ ++ gRt++++k++w++y
  Zmw_sc04844.1.g00010.1.am.mk 101 RGAFSQEEEDLIIHLHSVLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 145
                                   89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.6684395IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-254398IPR009057Homeodomain-like
SuperFamilySSF466891.35E-2946142IPR009057Homeodomain-like
SMARTSM007177.3E-134797IPR001005SANT/Myb domain
PfamPF002492.7E-154895IPR001005SANT/Myb domain
CDDcd001671.44E-115195No hitNo description
PROSITE profilePS5129426.79696150IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2699150IPR009057Homeodomain-like
SMARTSM007171.9E-15100148IPR001005SANT/Myb domain
PfamPF002493.3E-15101145IPR001005SANT/Myb domain
CDDcd001674.23E-11103146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
ARLSPSVRCP RLLATAVELE SSLGLLAAVA PAARMARRVA GPKKKLRRGL WSPEEDDKLM  60
NHIAKYGHGC WSSVPKLAGL ERCGKSCRLR WINYLRPDLK RGAFSQEEED LIIHLHSVLG  120
NKWSQIAAQL PGRTDNEVKN FWNSYIKKKL RQRGIDPATH KPLAVEAASS GRAASAASSR  180
SAVFVDAEFI LSSTTAGQHM PPLAVTAESY NDMYSHSSAE GGGSASAALV GGACSDGSLS  240
LSGYNQTADL ATGYLDPAVV LPSVSSSSTL NSIAGLSPAA TDEQCNNSNS AFESTPSCSA  300
AATDHLPWLE LGSSSYCTTA AAVDHYGAAL DELKWSEYVF DGYGAAQYQQ PGQGVYGDSK  360
DAVQFDADGL SSWCLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30461505108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958441.11e-149PREDICTED: myb-related protein Zm1-like
TrEMBLA0A0A9P2E31e-166A0A0A9P2E3_ARUDO; Uncharacterized protein
STRINGSi029872m1e-147(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385